PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A01857.2.p
Common NameEUGRSUZ_A01857
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 467aa    MW: 50825.9 Da    PI: 6.3905
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A01857.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like77.22.1e-24169221155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       k +++WtpeLH+rFv+aveqL G +kA+P++ilelm++++Lt+++++SHLQ YR+
  Eucgr.A01857.2.p 169 KVKVDWTPELHRRFVQAVEQL-GLDKAVPSRILELMGIDCLTRHNIASHLQ-YRS 221
                       5689*****************.****************************9.786 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.199166225IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.3E-24167225IPR009057Homeodomain-like
SuperFamilySSF466897.17E-15167219IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-23169221IPR006447Myb domain, plants
PfamPF002492.0E-6172218IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007165Biological Processsignal transduction
GO:0009658Biological Processchloroplast organization
GO:0009910Biological Processnegative regulation of flower development
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0010638Biological Processpositive regulation of organelle organization
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 467 aa     Download sequence    Send to blast
MLAVSPLRNP NDGSNNNQGE MESFSIGGGV GGSDDFPDFS DGSLLDSIDF DDLFMVINDG  60
DVLPDLEMDP ELLAEFSASC GEESGTGCSS ISVERAEVNN GSKREVDEDK ASELDNISSV  120
SRGEEIVSKR DDSVVVNPVP NNNEETDNKR KKSSAQSSKS NRQAQGKRKV KVDWTPELHR  180
RFVQAVEQLG LDKAVPSRIL ELMGIDCLTR HNIASHLQYR SHRKHMLARE AEAANWSQRR  240
HMHGNGGHKM RPDTMLVMSH STTPTNGSPW LAPATLGFPP VTPMPPHFRP LHVWGHPPAD  300
HSLMHVWPKH SPSLLPPPLP SAWASPPQGA APYGHQRVPN PPMPGTPCFV NPPLPATRFG  360
APPVPGIPPH AMYKVERKHN NNNNNDNNNR GYGVPPPGPL ASHPPFDFHP DYAFDEHSKE  420
TLDAAIGDVL AKPWLPLPLG LKPPSTESVV GELQRQGVPK IPPSCA*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00022PBMTransfer from AT2G20570Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A01857.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010052247.10.0PREDICTED: transcription activator GLK1-like
SwissprotQ9SIV32e-91GLK1_ARATH; Transcription activator GLK1
TrEMBLA0A059DFP40.0A0A059DFP4_EUCGR; Uncharacterized protein
STRINGGLYMA12G33430.11e-146(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20570.14e-77GBF's pro-rich region-interacting factor 1